PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000296025
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 512aa    MW: 56810.1 Da    PI: 7.2174
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000296025genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.41.4e-33214271260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    dDg+nWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d+++++i+Y+g+Hnh+k
  MDP0000296025 214 DDGFNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITQIVYKGNHNHPK 271
                    8****************************************.***************85 PP

2WRKY106.71.1e-33378436159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Cts gCpv+k+ver+++d+++v++tYeg+Hnh+
  MDP0000296025 378 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSVGCPVRKHVERASQDTRAVITTYEGKHNHD 436
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.8E-28206272IPR003657WRKY domain
PROSITE profilePS5081123.915208272IPR003657WRKY domain
SuperFamilySSF1182903.79E-25211272IPR003657WRKY domain
SMARTSM007741.9E-36213271IPR003657WRKY domain
PfamPF031062.3E-25214270IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-37363438IPR003657WRKY domain
SuperFamilySSF1182902.35E-29370438IPR003657WRKY domain
PROSITE profilePS5081138.538373438IPR003657WRKY domain
SMARTSM007743.2E-39378437IPR003657WRKY domain
PfamPF031067.9E-26379436IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MTSSFTHLLT SNMENSGIGQ DRTNWGGLFS DYSSNPNRFX DRNGTDIPKF KSLQPPSLPL  60
SPPPVSPSSY LTSTPAFSPT DFLSSPMFLS SSYNLESPTT GXFSSQVFDW MNNTKDTQQG  120
IKDKEEPKLF SDFSFQPESR PATNLQSSSS MVSVEEPFKG ERQAWDFSAE KTGVKSEFEP  180
IEANTQSNGL NGAPKSDYLH SNQCSQYARE QKSDDGFNWR KYGQKQVKGS ENPRSYYKCT  240
FPNCPTKKKV ERSLDGQITQ IVYKGNHNHP KPQSTRRSSS NSIQGSFYGI SDQSVPTLSN  300
PKVESVSLQE DSSTSIGEDE FEQNSPISNS VGAEDENEPE AKRWKGDNAN DQSYASSGGR  360
IVKEPRIVVQ TTSEIDILDD GYRWRKYGQK VVKGNPNPRS YYKCTSVGCP VRKHVERASQ  420
DTRAVITTYE GKHNHDVPAA RGSGNYSNAS RPAADNNSNN VSMAVRPLXL PNHSNLSYLN  480
SLQNARQPAT TESQPPYTLK MQSAGSYGFS EX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-37214439878Probable WRKY transcription factor 4
2lex_A1e-37214439878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.158840.0fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008350561.10.0PREDICTED: probable WRKY transcription factor 33 isoform X2
SwissprotQ8S8P51e-119WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLD9ZJG30.0D9ZJG3_MALDO; WRKY domain class transcription factor
STRINGPOPTR_0016s13600.11e-165(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-117WRKY DNA-binding protein 33